PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G59570.1
Common NameBOA, F2O15.230, PCLL
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 298aa    MW: 32366.9 Da    PI: 4.6058
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G59570.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.44.4e-30141194155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  AT5G59570.1 141 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 194
                  59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.019138197IPR017930Myb domain
SuperFamilySSF466891.7E-19138198IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.1E-31138199IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-23142194IPR006447Myb domain, plants
PfamPF002495.0E-8144193IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGKEVMVSDY GDDDGEDAGG GDEYRIPEWE IGLPNGDDLT PLSQYLVPSI LALAFSMIPE  60
RSRTIHDVNR ASQITLSSLR SSTNASSVME EVVDRVESSV PGSDPKKQKK SDGGEAAAVE  120
DSTAEEGDSG PEDASGKTSK RPRLVWTPQL HKRFVDVVAH LGIKNAVPKT IMQLMNVEGL  180
TRENVASHLQ KYRLYLKRIQ GLTTEEDPYS SSDQLFSSTP VPPQSFQDGG GSNGKLGVPV  240
PVPSMVPIPG YGNQMGMQGY YQQYSNHGNE SNQYMMQQNK FGTMVTYPSV GGGDVNDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-21140199463ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.292190.0root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306972490.0
Expression AtlasAT5G59570-
AtGenExpressAT5G59570-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that is a critical component of the regulatory circuit of the circadian clock. Binds to specific sites on CCA1 promoter leading to CCA1 activation. Is required for the rhythmic expression of other clock genes such as LHY, GI and APRR1/TOC1. {ECO:0000269|PubMed:21447790}.
Function -- GeneRIF ? help Back to Top
  1. BOA is rhythmically expressed in Arabidopsis and affects flowering time.
    [PMID: 21447790]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G59570.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT2G46830(A)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G59570
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0256040.0AB025604.1 Arabidopsis thaliana genomic DNA, chromosome 5, BAC clone:F2O15.
GenBankAB2065770.0AB206577.1 Arabidopsis thaliana PCLL gene for putative transcription factor, complete cds.
GenBankAK1173480.0AK117348.1 Arabidopsis thaliana At5g59570 mRNA for ARR1 like protein, complete cds, clone: RAFL16-91-G07.
GenBankBT0260650.0BT026065.1 Arabidopsis thaliana At5g59570 mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200765.10.0protein BROTHER OF LUX ARRHYTHMO
SwissprotQ9LTH40.0PCLL_ARATH; Transcription factor BOA
TrEMBLD7MSG31e-168D7MSG3_ARALL; Putative uncharacterized protein
STRINGAT5G59570.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40552758
Representative plantOGRP11571753
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  3. Hazen SP, et al.
    LUX ARRHYTHMO encodes a Myb domain protein essential for circadian rhythms.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(29): p. 10387-92
    [PMID:16006522]
  4. Onai K,Ishiura M
    PHYTOCLOCK 1 encoding a novel GARP protein essential for the Arabidopsis circadian clock.
    Genes Cells, 2005. 10(10): p. 963-72
    [PMID:16164597]
  5. Dai S, et al.
    BROTHER OF LUX ARRHYTHMO is a component of the Arabidopsis circadian clock.
    Plant Cell, 2011. 23(3): p. 961-72
    [PMID:21447790]
  6. Nemoto K, et al.
    Autophosphorylation profiling of Arabidopsis protein kinases using the cell-free system.
    Phytochemistry, 2011. 72(10): p. 1136-44
    [PMID:21477822]
  7. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  8. Huang H, et al.
    Identification of Evening Complex Associated Proteins in Arabidopsis by Affinity Purification and Mass Spectrometry.
    Mol. Cell Proteomics, 2016. 15(1): p. 201-17
    [PMID:26545401]